Traumatic Brain Injury Research Tools

View as table Download

Anti-FABP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 95-108 amino acids of Human Fatty acid-binding protein 3

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the N terminal of human FABP3. Synthetic peptide located within the following region: NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: DETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHG

FABP3 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human FABP3

FABP3 goat polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_004093.1.

Mouse Monoclonal H-FABP Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal H-FABP Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated

FABP3 mouse monoclonal antibody, clone 67D3, Purified

Applications ELISA, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FABP3 mouse monoclonal antibody, clone 66E2, Purified

Applications ELISA, IP, WB
Reactivities Human, Mouse, Porcine, Rat
Conjugation Unconjugated

FABP3 mouse monoclonal antibody, clone 22

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

FABP3 mouse monoclonal antibody, clone 30

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

FABP3 mouse monoclonal antibody, clone 31

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

FABP3 mouse monoclonal antibody, clone 10E1

Applications ELISA
Reactivities Human
Conjugation Unconjugated

FABP3 mouse monoclonal antibody, clone 25

Applications ELISA
Reactivities Human
Conjugation Unconjugated