Germany
Japan
United Kingdom
China
Traumatic Brain Injury Research Tools
View as table Download
Rabbit polyclonal CKII alpha (CSNK2A1) Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, Chicken, Rabbit, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This CKII alpha (CSNK2A1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 240-269 amino acids from the Central region of human CKII alpha (CSNK2A1). |
Rabbit polyclonal anti-CSNK2B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CSNK2B |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CKII alpha (CSNK2A1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-CSNK2A2 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CSNK2A2 |
CKII alpha (CSNK2A1) pThr360/pSer362 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of Threonine 360/Serine 362 |
CKII alpha (CSNK2A1) pThr360/pSer362 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of Threonine 360/Serine 362 |
CKII alpha (CSNK2A1) (353-357) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa. 353~357 |
CKII alpha (CSNK2A1) (353-357) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa. 353~357 |
Rabbit Polyclonal Antibody against CSNK2B (C-term F168)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Bovine, Chicken, Pig, Rabbit, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This CSNK2B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-184 amino acids from the C-terminal region of human CSNK2B. |
Rabbit Polyclonal Anti-CSNK2A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CSNK2A2 Antibody: synthetic peptide directed towards the C terminal of human CSNK2A2. Synthetic peptide located within the following region: GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD |
Rabbit Polyclonal Anti-CSNK2A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CSNK2A2 Antibody: synthetic peptide directed towards the C terminal of human CSNK2A2. Synthetic peptide located within the following region: LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
Active filters
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Tight junction