Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
Applications | FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat (Predicted: Chimpanzee) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259) |
BDNF rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Highly purified (>98%) E.coli derived, 27.0 kDa recombinant Human/Mouse/Rat BDNF (Cat.-No PA047) |
Rabbit Anti-NSE (Neuron specific enolase) Antibody
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant human NSE expressed in and purified from E. coli |
BDNF rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Highly purified (>98%) E.coli derived, 27.0 kDa recombinant Human/Mouse/Rat BDNF (Cat.-No PA047) |
Anti-KRT23 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-250 amino acids of human keratin 23 (histone deacetylase inducible) |
Rabbit polyclonal anti-GAD67/GAD1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GAD67. |
Modifications | Phospho-specific |
Rabbit polyclonal Keratin 19 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Keratin 19. |
Rabbit polyclonal anti-CKI-a antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CKI-a. |
BDNF rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Immunogen | E.coli-derived, 27.0 kDa Recombinant Human/Mouse/Rat BDNF (Cat.-No PA047). |
BDNF rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Immunogen | E.coli-derived, 27.0 kDa Recombinant Human/Mouse/Rat BDNF (Cat.-No PA047). |
Fabp6 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KRT1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KRT1 antibody: synthetic peptide directed towards the middle region of human KRT1. Synthetic peptide located within the following region: GSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKS |
Rabbit Polyclonal Anti-CCL18 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCL18 antibody: synthetic peptide directed towards the middle region of human CCL18. Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |