Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat (Predicted: Chimpanzee) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259) |
BDNF rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Highly purified (>98%) E.coli derived, 27.0 kDa recombinant Human/Mouse/Rat BDNF (Cat.-No PA047) |
BDNF rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Highly purified (>98%) E.coli derived, 27.0 kDa recombinant Human/Mouse/Rat BDNF (Cat.-No PA047) |
BDNF rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | E.coli-derived, 27.0 kDa Recombinant Human/Mouse/Rat BDNF (Cat.-No PA047). |
BDNF rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | E.coli-derived, 27.0 kDa Recombinant Human/Mouse/Rat BDNF (Cat.-No PA047). |
Fabp6 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KRT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT1 antibody: synthetic peptide directed towards the middle region of human KRT1. Synthetic peptide located within the following region: GSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKS |
Rabbit Polyclonal Anti-CCL18 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCL18 antibody: synthetic peptide directed towards the middle region of human CCL18. Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
BDNF rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide mapping at the middle region of human BDNF |
Germany
Japan
United Kingdom
China
