Anti-FABP4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-FABP4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Mouse monoclonal anti-FABP4 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
FABP4 mouse monoclonal antibody, clone 3F4, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit anti-FABP4 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FABP4 |
FABP4 mouse monoclonal antibody, clone 9B8D, Ascites
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FABP4 mouse monoclonal antibody, clone 3F4, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FABP4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP4 antibody: synthetic peptide directed towards the middle region of human FABP4. Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM |
FABP4 mouse monoclonal antibody, clone 5H11A4E11, Ascites
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
FABP4 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide corresponding to amino acid residues surrounding Y20 of human FABP4. |
FABP4 goat polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Canine, Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001433.1. |
Rabbit Polyclonal Anti-FABP4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP4 antibody: synthetic peptide directed towards the middle region of human FABP4. Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM |
FABP4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human FABP4 |
FABP4 rabbit polyclonal antibody, Azide Free
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunization antigen (14.7 kDa) is a protein containing 131 AA of recombinant Human FABP4 and one extra AA, N-terminal Methionin (highlighted). |