Traumatic Brain Injury Research Tools

View as table Download

Anti-FABP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-FABP4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP4 antibody: synthetic peptide directed towards the middle region of human FABP4. Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM

FABP4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human FABP4

FABP4 rabbit polyclonal antibody, Azide Free

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunization antigen (14.7 kDa) is a protein containing 131 AA of recombinant Human FABP4 and one extra AA, N-terminal Methionin (highlighted).