Germany
Japan
United Kingdom
China
Traumatic Brain Injury Research Tools
View as table Download
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat (Predicted: Chimpanzee) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259) |
BDNF rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Highly purified (>98%) E.coli derived, 27.0 kDa recombinant Human/Mouse/Rat BDNF (Cat.-No PA047) |
BDNF rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Highly purified (>98%) E.coli derived, 27.0 kDa recombinant Human/Mouse/Rat BDNF (Cat.-No PA047) |
Fabp6 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KRT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT1 antibody: synthetic peptide directed towards the middle region of human KRT1. Synthetic peptide located within the following region: GSYGSGSSSGGYRGGSGGGGGGSSGGRGSGGGSSGGSIGGRGSSSGGVKS |
Rabbit Polyclonal Anti-CCL18 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCL18 antibody: synthetic peptide directed towards the middle region of human CCL18. Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
Rabbit Monoclonal GFAP Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
GFAP rabbit polyclonal antibody, Purified
| Applications | IF, IHC |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified Human GFAP. |
Active filters
Filter by
Target Symbol
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Assay Types
Families
Pathways
- Alanine (2)
- Butanoate metabolism (2)
- Metabolic pathways (2)
- Parkinson's disease (2)
- Taurine and hypotaurine metabolism (2)
- Type I diabetes mellitus (2)
- aspartate and glutamate metabolism (2)
- beta-Alanine metabolism (2)
- Chemokine signaling pathway (1)
- Cytokine-cytokine receptor interaction (1)
- Hedgehog signaling pathway (1)
- Wnt signaling pathway (1)