Traumatic Brain Injury Research Tools

View as table Download

Casein Kinase 1 alpha (CSNK1A1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 150-200 of Human Casein Kinase Iα

Casein Kinase 1 alpha (CSNK1A1) (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human CK1a.

Casein Kinase 1 alpha (CSNK1A1) pTyr294 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 294 (Y-D-Y(p)-T-F) derived from Human CK-1α (KLH-conjugated)

Casein Kinase 1 alpha (CSNK1A1) pTyr294 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 294 (Y-D-Y(p)-T-F) derived from Human CK-1α (KLH-conjugated)

Rabbit Polyclonal Anti-Csnk1a1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Csnk1a1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Csnk1a1. Synthetic peptide located within the following region: FGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIR