Melanosomal Markers

Jump to Filters
View as table Download
MelanA (MLANA) Rabbit Polyclonal Antibody
TA371944

USD 380.00

4 Weeks

MLANA rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MLANA
DMT1 (SLC11A2) Rabbit Polyclonal Antibody
TA381538

USD 365.00

3 Weeks

DMT1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DMT1 (NP_000608.1).
Modifications Unmodified
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA335247

USD 485.00

5 Days

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the N terminal of human TYRP1. Synthetic peptide located within the following region: AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA335248

USD 539.00

5 Days

Rabbit Polyclonal Anti-Tyrp1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Tyrp1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: AHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLEN
TRP2 (DCT) Rabbit Polyclonal Antibody
TA375357

USD 365.00

3 Weeks

DCT Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-350 of human DCT (NP_001913.2).
Modifications Unmodified
OA1 (GPR143) Rabbit Polyclonal Antibody
TA376726

USD 365.00

3 Weeks

GPR143 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 314-404 of human GPR143 (NP_000264.2).
Modifications Unmodified