MLANA rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MLANA |
MLANA rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MLANA |
DMT1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DMT1 (NP_000608.1). |
Modifications | Unmodified |
Rabbit Polyclonal Anti-TYRP1 Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the N terminal of human TYRP1. Synthetic peptide located within the following region: AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF |
Rabbit Polyclonal Anti-Tyrp1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Tyrp1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: AHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLEN |
DCT Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-350 of human DCT (NP_001913.2). |
Modifications | Unmodified |
GPR143 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 314-404 of human GPR143 (NP_000264.2). |
Modifications | Unmodified |