Germany
Japan
United Kingdom
China
Liver Diseases
View as table Download
Goat Polyclonal Anti-SLC40A1 (aa245-259) Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC40A1 (aa245-259) Antibody: Peptide with sequence C-ELKQLNLHKDTEPKP, from the internal region of the protein sequence according to NP_055400.1. |
Rabbit Polyclonal Anti-SLC40A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC40A1 Antibody: synthetic peptide directed towards the middle region of human SLC40A1. Synthetic peptide located within the following region: GSPLDLSVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPE |
Active filters
Target Symbol
- SLC40A1
Isotypes
- IgG