Germany
Japan
United Kingdom
China
F2RL1 (tGFP-tagged) - Human coagulation factor II (thrombin) receptor-like 1 (F2RL1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Liver Diseases
View as table Download
F2RL1 (untagged)-Human coagulation factor II (thrombin) receptor-like 1 (F2RL1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
F2RL1 (untagged)-Human coagulation factor II (thrombin) receptor-like 1 (F2RL1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-F2RL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2RL1 antibody is: synthetic peptide directed towards the C-terminal region of Human F2RL1. Synthetic peptide located within the following region: SAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICFTPSNLLLVV |
Active filters
Target Symbol
- PAR2
Families
- Transmembrane