Germany
Japan
United Kingdom
China
OR51F2 (Myc-DDK-tagged)-Human olfactory receptor, family 51, subfamily F, member 2 (OR51F2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Liver Diseases
View as table Download
OR51F2 (tGFP-tagged) - Human olfactory receptor, family 51, subfamily F, member 2 (OR51F2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human olfactory receptor, family 51, subfamily F, member 2 (OR51F2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human olfactory receptor, family 51, subfamily F, member 2 (OR51F2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, OR51F2 (Myc-DDK tagged) - Human olfactory receptor, family 51, subfamily F, member 2 (OR51F2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, OR51F2 (mGFP-tagged) - Human olfactory receptor, family 51, subfamily F, member 2 (OR51F2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-OR51F2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR51F2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR51F2. Synthetic peptide located within the following region: DCPCILLSYILIIRSVLSIASSEERRKAFNTCTSHISAVSIFYLPLISLS |
OR51F2 (untagged)-Human olfactory receptor, family 51, subfamily F, member 2 (OR51F2)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- OR51F2
Families
- Transmembrane