OR2F2 (Myc-DDK-tagged)-Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
OR2F2 (Myc-DDK-tagged)-Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
OR2F2 (tGFP-tagged) - Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
OR2F2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 294-317 amino acids from the C-terminal region of Human Olfactory receptor 2F2 |
Lenti ORF clone of Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, OR2F2 (Myc-DDK tagged) - Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, OR2F2 (mGFP-tagged) - Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit polyclonal anti-OR2F2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR2F2. |
Rabbit Polyclonal Anti-OR2F2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR2F2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2F2. Synthetic peptide located within the following region: PHSGPSVLQEKLISVFYAIVMPLLNPVIYSLRNKEVKGAWHKLLEKFSGL |
OR2F2 (untagged)-Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |