USD 575.00
In Stock
GRHL1 (Myc-DDK-tagged)-Human grainyhead-like 1 (Drosophila) (GRHL1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 575.00
In Stock
GRHL1 (Myc-DDK-tagged)-Human grainyhead-like 1 (Drosophila) (GRHL1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 575.00
In Stock
GRHL1 (Myc-DDK-tagged)-Human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,125.00
5 Weeks
Lenti ORF particles, GRHL1 (Myc-DDK tagged) - Human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,125.00
5 Weeks
Lenti ORF particles, GRHL1 (mGFP-tagged) - Human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,125.00
5 Weeks
Lenti ORF particles, GRHL1 (Myc-DDK tagged) - Human grainyhead-like 1 (Drosophila) (GRHL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,125.00
5 Weeks
Lenti ORF particles, GRHL1 (mGFP-tagged) - Human grainyhead-like 1 (Drosophila) (GRHL1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 867.00
In Stock
Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1, 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 775.00
In Stock
GRHL1 (tGFP-tagged) - Human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 867.00
In Stock
Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 9,200.00
6 Weeks
Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1, 1 mg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 2,950.00
6 Weeks
Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1, 100 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 9,200.00
6 Weeks
Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), 1 mg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 2,950.00
6 Weeks
Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), 100 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 775.00
3 Weeks
GRHL1 (tGFP-tagged) - Human grainyhead-like 1 (Drosophila) (GRHL1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-GRHL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRHL1 antibody: synthetic peptide directed towards the N terminal of human GRHL1. Synthetic peptide located within the following region: GENRVQVLKNVPFNIVLPHGNQLGIDKRGHLTAPDTTVTVSIATMPTHSI |