Germany
Japan
United Kingdom
China
USD 575.00
In Stock
GRHL1 (Myc-DDK-tagged)-Human grainyhead-like 1 (Drosophila) (GRHL1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Liver Diseases
View as table Download
USD 575.00
In Stock
GRHL1 (Myc-DDK-tagged)-Human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 1,125.00
5 Weeks
Lenti ORF particles, GRHL1 (Myc-DDK tagged) - Human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,125.00
5 Weeks
Lenti ORF particles, GRHL1 (mGFP-tagged) - Human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,125.00
5 Weeks
Lenti ORF particles, GRHL1 (Myc-DDK tagged) - Human grainyhead-like 1 (Drosophila) (GRHL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,125.00
5 Weeks
Lenti ORF particles, GRHL1 (mGFP-tagged) - Human grainyhead-like 1 (Drosophila) (GRHL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 867.00
In Stock
Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1, 20 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 775.00
In Stock
GRHL1 (tGFP-tagged) - Human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 867.00
In Stock
Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), 20 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 9,200.00
6 Weeks
Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1, 1 mg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 2,950.00
6 Weeks
Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), transcript variant 1, 100 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 9,200.00
6 Weeks
Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), 1 mg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 2,950.00
6 Weeks
Recombinant protein of human grainyhead-like 1 (Drosophila) (GRHL1), 100 µg
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 775.00
3 Weeks
GRHL1 (tGFP-tagged) - Human grainyhead-like 1 (Drosophila) (GRHL1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-GRHL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRHL1 antibody: synthetic peptide directed towards the N terminal of human GRHL1. Synthetic peptide located within the following region: GENRVQVLKNVPFNIVLPHGNQLGIDKRGHLTAPDTTVTVSIATMPTHSI |
Active filters
Target Symbol
- GRAINYHEAD LIKE PROTEIN 1 HOMOLOG
Families
- Transmembrane