ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant C
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ABCB4 (tGFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ABCB4 (tGFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant C
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ABCB4 (tGFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ABCB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM |
Lenti-ORF clone of ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-ABCB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the middle region of human ABCB4. Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV |
Lenti-ORF clone of ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti-ORF clone of ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant C
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |