Germany
Japan
United Kingdom
China
ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Liver Diseases
View as table Download
ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant C
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCB4 (tGFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCB4 (tGFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant C
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCB4 (tGFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-ABCB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM |
Lenti-ORF clone of ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-ABCB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the middle region of human ABCB4. Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV |
Lenti-ORF clone of ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti-ORF clone of ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant C
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Active filters
Target Symbol
- ABCB4
Families
- Transmembrane