Liver Diseases

View as table Download

OR2F2 (Myc-DDK-tagged)-Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

OR51F2 (Myc-DDK-tagged)-Human olfactory receptor, family 51, subfamily F, member 2 (OR51F2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

OR2F2 (tGFP-tagged) - Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

OR51F2 (tGFP-tagged) - Human olfactory receptor, family 51, subfamily F, member 2 (OR51F2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

OR2F2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 294-317 amino acids from the C-terminal region of Human Olfactory receptor 2F2

Lenti ORF clone of Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human olfactory receptor, family 51, subfamily F, member 2 (OR51F2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human olfactory receptor, family 51, subfamily F, member 2 (OR51F2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, OR2F2 (Myc-DDK tagged) - Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, OR2F2 (mGFP-tagged) - Human olfactory receptor, family 2, subfamily F, member 2 (OR2F2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, OR51F2 (Myc-DDK tagged) - Human olfactory receptor, family 51, subfamily F, member 2 (OR51F2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, OR51F2 (mGFP-tagged) - Human olfactory receptor, family 51, subfamily F, member 2 (OR51F2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit polyclonal anti-OR2F2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2F2.

Rabbit Polyclonal Anti-OR51F2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR51F2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR51F2. Synthetic peptide located within the following region: DCPCILLSYILIIRSVLSIASSEERRKAFNTCTSHISAVSIFYLPLISLS