Germany
Japan
United Kingdom
China
Rabbit Polyclonal Ferroportin 1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human protein (within residues 250-300). [Swiss-Prot# Q9NP59] |
Liver Diseases
View as table Download
SLC40A1 (Myc-DDK-tagged)-Human solute carrier family 40 (iron-regulated transporter), member 1 (SLC40A1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SLC40A1 (tGFP-tagged) - Human solute carrier family 40 (iron-regulated transporter), member 1 (SLC40A1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SLC40A1 (untagged)-Human solute carrier family 40 (iron-regulated transporter), member 1 (SLC40A1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of SLC40A1 (Myc-DDK-tagged)-Human solute carrier family 40 (iron-regulated transporter), member 1 (SLC40A1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti-ORF clone of SLC40A1 (Myc-DDK-tagged)-Human solute carrier family 40 (iron-regulated transporter), member 1 (SLC40A1)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of SLC40A1 (mGFP-tagged)-Human solute carrier family 40 (iron-regulated transporter), member 1 (SLC40A1)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of SLC40A1 (mGFP-tagged)-Human solute carrier family 40 (iron-regulated transporter), member 1 (SLC40A1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SLC40A1 (Myc-DDK-tagged)-Human solute carrier family 40 (iron-regulated transporter), member 1 (SLC40A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, SLC40A1 (mGFP-tagged)-Human solute carrier family 40 (iron-regulated transporter), member 1 (SLC40A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, SLC40A1 (Myc-DDK-tagged)-Human solute carrier family 40 (iron-regulated transporter), member 1 (SLC40A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, SLC40A1 (mGFP-tagged)-Human solute carrier family 40 (iron-regulated transporter), member 1 (SLC40A1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Goat Polyclonal Anti-SLC40A1 (aa245-259) Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC40A1 (aa245-259) Antibody: Peptide with sequence C-ELKQLNLHKDTEPKP, from the internal region of the protein sequence according to NP_055400.1. |
Rabbit Polyclonal Anti-SLC40A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC40A1 Antibody: synthetic peptide directed towards the middle region of human SLC40A1. Synthetic peptide located within the following region: GSPLDLSVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPE |
Active filters
Target Symbol
- SLC40A1
Families
- Druggable Genome