Liver Diseases

View as table Download

LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti-LTBR Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LTBR

Rabbit polyclonal anti-LTBR antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LTBR.

LTBR Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human LTBR

LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications WB
Reactivities Human
Conjugation Unconjugated

LTBR rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

LTBR (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 28-57 amino acids from the N-terminal region of human LTBR

Rabbit Polyclonal anti-LTBR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LTBR antibody is: synthetic peptide directed towards the N-terminal region of Human LTBR. Synthetic peptide located within the following region: VLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTY