Liver Diseases

View as table Download

Rabbit Polyclonal Anti-PTGFR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGFR antibody is: synthetic peptide directed towards the C-terminal region of Human PTGFR. Synthetic peptide located within the following region: RFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQGRSHHLEMV

Rabbit Polyclonal Anti-PTGFR Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human (Predicted: Monkey, Rat, Xenopus)
Conjugation Unconjugated
Immunogen FP / PTGFR antibody was raised against synthetic 14 amino acid peptide from 1st cytoplasmic domain of human PTGFR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Elephant, Panda, Bat, Dog, Rabbit, Horse, Turkey, Chicken, Platypus (100%); Marmoset, Rat, Xenopus (93%); Sheep, Bovine, Pig (86%).