Liver Diseases

cDNA Clones (30)
Antibodies (24)
Proteins (11)
Jump to Filters
View as table Download
EGFR Mouse Monoclonal Antibody [Clone ID: OTI3F2]
TA802016

USD 447.00

In Stock

EGFR mouse monoclonal antibody,clone OTI3F2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EGFR Mouse Monoclonal Antibody [Clone ID: OTI3F2]
CF802016

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone OTI3F2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA321416

USD 380.00

4 Weeks

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA328618

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-Human Protease-activated Receptor-1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide (C)KNESGLTEYRLVSINK, corresponding to amino acid residues 61-76 of human PAR-1. Extracellular, N terminal.
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA321415

USD 380.00

In Stock

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor
Thrombin Receptor (F2R) Goat Polyclonal Antibody
TA305911

USD 520.00

In Stock

Goat Anti-F2R / PAR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TRARRPESKATNAT, from the Internal region (near N-terminus) of the protein sequence according to NP_001983.2.
Thrombin Receptor (F2R) (24-37) Goat Polyclonal Antibody
AP23067PU-N

USD 555.00

2 Weeks

Thrombin Receptor (F2R) (24-37) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide from the Internal region (near N-terminus) of the human protein sequence according to NP_001983.2
EGFR Mouse Monoclonal Antibody [Clone ID: OTI3F2]
TA802016S

USD 200.00

2 Days

EGFR mouse monoclonal antibody,clone OTI3F2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Prostaglandin F2 alpha Receptor (PTGFR) Rabbit Polyclonal Antibody
TA338356

USD 539.00

5 Days

Rabbit Polyclonal Anti-PTGFR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGFR antibody is: synthetic peptide directed towards the C-terminal region of Human PTGFR. Synthetic peptide located within the following region: RFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQGRSHHLEMV
EGFR Mouse Monoclonal Capture Antibody [Clone ID: OTI3F2]
TA600473

USD 229.00

USD 458.00

In Stock

purified EGFR mouse monoclonal capture antibody, validated for Luminex assays

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700472
CD38 Mouse Monoclonal Antibody [Clone ID: T16]
AM39017AC-N

USD 795.00

2 Weeks

CD38 mouse monoclonal antibody, clone T16, APC

Applications FC, IF
Reactivities Human
Conjugation APC
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA313854

USD 380.00

In Stock

Rabbit polyclonal Thrombin Receptor antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Thrombin Receptor.