Liver Diseases

Antibodies (3)
View as table Download

ABCB4 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 624-654 amino acids from the Central region of Human ABCB4.

Rabbit Polyclonal Anti-ABCB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM

ABCB4 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABCB4