Liver Diseases

View as table Download

F2RL1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-F2RL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2RL1 antibody is: synthetic peptide directed towards the C-terminal region of Human F2RL1. Synthetic peptide located within the following region: SAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICFTPSNLLLVV