Liver Diseases

View as table Download

TNFRSF1A mouse monoclonal antibody, clone htr9, Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

TNFRSF1A mouse monoclonal antibody, clone htr9, Azide Free

Applications FC, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated

TNFRSF1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human TNFRSF1A

TNFRSF1A rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 370-420 of Human TNF-R1.

Rabbit anti-TNF-R1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNF-R1

TNFRSF1A pSer274 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S274 of human TNFR.

TNFRSF1A (195-211) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Goat, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequencein the middle region of Human TNFR1 (aa 195-211).

TNFRSF1A mouse monoclonal antibody, clone MR1-2, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-TNFRSF1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI

TNFRSF1A (full length) mouse monoclonal antibody, clone H398, Purified

Applications ELISA, FC, FN, IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit polyclonal TNF Receptor-1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1.

Tnfrsf1a rat monoclonal antibody, clone HM104, Purified

Applications ELISA, FC, IHC, IP
Reactivities Mouse
Conjugation Unconjugated

TNFRSF1A rabbit polyclonal antibody, Serum

Applications ELISA, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant Human sTNFRp55 expressed in Chinese Hamster Cells.

TNFRSF1A rabbit polyclonal antibody, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant human sTNFRp55 expressed in Chinese Hamster Cells.

TNFRSF1A (full length) mouse monoclonal antibody, clone H398, Low Endotoxin

Applications FC, FN, IHC, IP
Reactivities Human
Conjugation Unconjugated