Liver Diseases

Jump to Filters
View as table Download
SLC40A1 Rabbit Polyclonal Antibody
TA372564

USD 380.00

4 Weeks

SLC40A1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC40A1
SLC40A1 Rabbit Polyclonal Antibody
TA351699

USD 380.00

In Stock

Rabbit Polyclonal Anti-SLC40A1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC40A1
SLC40A1 Rabbit Polyclonal Antibody
TA368323

USD 380.00

4 Weeks

SLC40A1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC40A1
SLC40A1 Rabbit Polyclonal Antibody
TA333866

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC40A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC40A1 Antibody: synthetic peptide directed towards the middle region of human SLC40A1. Synthetic peptide located within the following region: GSPLDLSVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPE