Germany
Japan
United Kingdom
China
Canine Parvovirus mouse monoclonal antibody, clone CPV1-2A1, Purified
| Applications | ELISA, IHC |
| Reactivities | Canine, Feline |
| Conjugation | Unconjugated |
Infectious Diseases
View as table DownloadUSD 265.00
2 Weeks
Hantavirus (Puumala Nucleocapsid) mouse monoclonal antibody, clone A1C5, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Puumala Virus |
| Conjugation | Unconjugated |
USD 265.00
2 Weeks
Hantavirus (Hantaan Nucleocapsid) mouse monoclonal antibody, clone B5D9, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Hantaan Virus |
| Conjugation | Unconjugated |
Recombinant Anti-Flavivirus group antigen (Clone D1-4G2-4-15 (4G2))
| Applications | Bl, ELISA, FC, IF, IHC, WB |
| Reactivities | Dengue virus, West Nile Virus, Yellow Fever Virus |
| Conjugation | Unconjugated |
Adenovirus (Hexon) mouse monoclonal antibody, clone B025 (AD51), Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Adeno-associated Virus 3 |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CXADR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CXADR Antibody: synthetic peptide directed towards the N terminal of human CXADR. Synthetic peptide located within the following region: ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK |
Rabbit Polyclonal Anti-CXADR Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXADR antibody was raised against synthetic 15 amino acid peptide from internal region of human CXADR. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Zebra finch, Platypus, Lizard (93%); Xenopus, Stickleback, Pufferfish, Zebrafish (80%). |
Rabbit polyclonal anti-CXADR antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CXADR. |
Recombinant Anti-Flavivirus group antigen (Clone D1-4G2-4-15 (4G2))
| Applications | ELISA, FC, IF, IHC, Neutralize, WB |
| Reactivities | Dengue virus, West Nile Virus, Yellow Fever Virus |
| Conjugation | Unconjugated |
Rotavirus (Group A) mouse monoclonal antibody, clone 0581, Purified
| Applications | ELISA, IF |
| Reactivities | Rotavirus |
| Conjugation | Unconjugated |
Adenovirus E1A (E1A) sheep polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Adeno-associated Virus |
| Conjugation | Unconjugated |
| Immunogen | GST-EIA fusion protein recognizing a 43kD protein. |
USD 340.00
2 Weeks
Hantavirus (Seoul Nucleocapsid) mouse monoclonal antibody, clone R31, Supernatant
| Applications | ELISA, IF, IHC |
| Reactivities | Seoul Virus |
| Conjugation | Unconjugated |
Active filters
Conjugates
- Unconjugated
Filter by
Category
Target Symbol
Reactivities
- Human (17)
- Mouse (6)
- Rotavirus (6)
- Adeno-associated Virus (5)
- Rat (5)
- Adeno-associated Virus 1 (4)
- Adeno-associated Virus 3 (4)
- Adeno-associated Virus 5 (4)
- Adeno-associated Virus 2 (3)
- Adeno-associated Virus 6 (3)
- Adeno-associated Virus 14 (2)
- Adeno-associated Virus 31 (2)
- Adeno-associated Virus 4 (2)
- Adeno-associated Virus 40 (2)
- Adeno-associated Virus 41 (2)
- Adeno-associated Virus 8 (2)
- Bovine Adenovirus 1 (2)
- Canine Adenovirus 1 (2)
- Dengue virus (2)
- Norovirus (2)
- West Nile Virus (2)
- Yellow Fever Virus (2)
- Adeno-associated Virus 10 (1)
- Adeno-associated Virus 11 (1)
- Adeno-associated Virus 13 (1)
- Adeno-associated Virus 18 (1)
- Adeno-associated Virus 20 (1)
- Adeno-associated Virus 26 (1)
- Adeno-associated Virus 7 (1)
- Adeno-associated Virus 7a (1)
- Adeno-associated Virus 9 (1)
- Canine (1)
- Feline (1)
- Hantaan Virus (1)
- Human Astrovirus (1)
- Human Papilloma Virus 1 (1)
- Human Papilloma Virus 2 (1)
- Human Papilloma Virus 3 (1)
- Nebraska Calf Diarrhoea Virus (1)
- Puumala Virus (1)
- Seoul Virus (1)