Rabbit polyclonal antibody to PVRL2(CD112) (poliovirus receptor-related 2 (herpesvirus entry mediator B))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 270 and 499 of Nectin 2 (Uniprot ID#Q92692) |
Rabbit Polyclonal Anti-ZNF395 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF395 Antibody: synthetic peptide directed towards the middle region of human ZNF395. Synthetic peptide located within the following region: SGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEP |
Rabbit anti-CXADR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CXADR |
Rabbit Polyclonal Anti-PVRL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the N terminal of human PVRL3. Synthetic peptide located within the following region: SGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAI |
Rabbit Polyclonal Anti-PVRL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the middle region of human PVRL3. Synthetic peptide located within the following region: PDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKM |
Rabbit Polyclonal Anti-ZNF395 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF395 antibody: synthetic peptide directed towards the middle region of human ZNF395. Synthetic peptide located within the following region: HLIVTSPPRAQSGARKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRFL |
Rabbit anti HPV (IN) (Human Papillomavirus), E7 protein Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence of human papillomavirus type 16. |
Rabbit anti HPV (NT) (Human Papillomavirus), E7 protein Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of human papillomavirus type 16. |
Adenovirus (Hexon) mouse monoclonal antibody, clone 2C4, Purified
| Applications | ELISA, IF, WB |
| Reactivities | Adeno-associated Virus |
| Conjugation | Unconjugated |
Rotavirus (capsid protein) mouse monoclonal antibody, clone 521, Purified
| Applications | ELISA, WB |
| Reactivities | Rotavirus |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China