Germany
Japan
United Kingdom
China
USD 265.00
2 Weeks
Hantavirus (Puumala Nucleocapsid) mouse monoclonal antibody, clone A1C5, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Puumala Virus |
| Conjugation | Unconjugated |
Infectious Diseases
View as table Download
USD 265.00
2 Weeks
Hantavirus (Hantaan Nucleocapsid) mouse monoclonal antibody, clone B5D9, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Hantaan Virus |
| Conjugation | Unconjugated |
Recombinant Anti-Flavivirus group antigen (Clone D1-4G2-4-15 (4G2))
| Applications | Bl, ELISA, FC, IF, IHC, WB |
| Reactivities | Dengue virus, West Nile Virus, Yellow Fever Virus |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CXADR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CXADR Antibody: synthetic peptide directed towards the N terminal of human CXADR. Synthetic peptide located within the following region: ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK |
Rabbit polyclonal anti-CXADR antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CXADR. |
Recombinant Anti-Flavivirus group antigen (Clone D1-4G2-4-15 (4G2))
| Applications | ELISA, FC, IF, IHC, Neutralize, WB |
| Reactivities | Dengue virus, West Nile Virus, Yellow Fever Virus |
| Conjugation | Unconjugated |
Adenovirus E1A (E1A) sheep polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Adeno-associated Virus |
| Conjugation | Unconjugated |
| Immunogen | GST-EIA fusion protein recognizing a 43kD protein. |
Rabbit Polyclonal Anti-ZNF395 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF395 Antibody: synthetic peptide directed towards the C terminal of human ZNF395. Synthetic peptide located within the following region: GLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAY |
Rabbit anti-PVR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PVR |
Adenovirus goat polyclonal antibody, Purified
| Applications | ELISA, IF, WB |
| Reactivities | Adeno-associated Virus 2, Adeno-associated Virus 3, Adeno-associated Virus 4, Adeno-associated Virus 5, Adeno-associated Virus 6 |
| Conjugation | Unconjugated |
| Immunogen | Disrupted type 5 virions |
CXADR (Center) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from in between 140-169 amino acids from the Center region of human CXADR. |
Adenovirus (Hexon) mouse monoclonal antibody, clone 3G0, Purified
| Applications | ELISA, IF, WB |
| Reactivities | Adeno-associated Virus |
| Conjugation | Unconjugated |
Active filters
Applications
- WB
Conjugates
- Unconjugated
Filter by
Category
Target Symbol
Reactivities
- Human (16)
- Mouse (6)
- Rat (5)
- Adeno-associated Virus (3)
- Dengue virus (2)
- West Nile Virus (2)
- Yellow Fever Virus (2)
- Adeno-associated Virus 2 (1)
- Adeno-associated Virus 3 (1)
- Adeno-associated Virus 4 (1)
- Adeno-associated Virus 5 (1)
- Adeno-associated Virus 6 (1)
- Hantaan Virus (1)
- Puumala Virus (1)
- Rotavirus (1)