Germany
Japan
United Kingdom
China
Infectious Diseases
View as table Download
Recombinant Anti-Flavivirus group antigen (Clone D1-4G2-4-15 (4G2))
| Applications | Bl, ELISA, FC, IF, IHC, WB |
| Reactivities | Dengue virus, West Nile Virus, Yellow Fever Virus |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CXADR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CXADR Antibody: synthetic peptide directed towards the N terminal of human CXADR. Synthetic peptide located within the following region: ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK |
Rabbit polyclonal anti-CXADR antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CXADR. |
Rabbit Polyclonal Anti-ZNF395 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF395 Antibody: synthetic peptide directed towards the C terminal of human ZNF395. Synthetic peptide located within the following region: GLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAY |
Rabbit anti-PVR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PVR |
CXADR (Center) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from in between 140-169 amino acids from the Center region of human CXADR. |
Rabbit polyclonal antibody to PVRL2(CD112) (poliovirus receptor-related 2 (herpesvirus entry mediator B))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 270 and 499 of Nectin 2 (Uniprot ID#Q92692) |
Rabbit Polyclonal Anti-ZNF395 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF395 Antibody: synthetic peptide directed towards the middle region of human ZNF395. Synthetic peptide located within the following region: SGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEP |
Rabbit anti-CXADR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CXADR |
Rabbit Polyclonal Anti-PVRL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the N terminal of human PVRL3. Synthetic peptide located within the following region: SGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAI |
Rabbit Polyclonal Anti-PVRL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the middle region of human PVRL3. Synthetic peptide located within the following region: PDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKM |
Rabbit Polyclonal Anti-ZNF395 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF395 antibody: synthetic peptide directed towards the middle region of human ZNF395. Synthetic peptide located within the following region: HLIVTSPPRAQSGARKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRFL |
Active filters
Applications
- WB
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated