Autoimmunity

View as table Download

Rabbit polyclonal HLA-G Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G.

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Rabbit polyclonal HLA-B Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B.

Rabbit Polyclonal TNF-alpha Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

Anti-TNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)

Applications IHC, WB
Reactivities Human (Predicted: Bovine)
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

Rabbit polyclonal Anti-HLA-F Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT

HLA-DOA rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

HLADQA1 (HLA-DQA1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 56-84 amino acids from the Central region of Human HLA class II DQ alpha 1 / HLA-DQA1

Rabbit polyclonal antibody to HLA-DMB (major histocompatibility complex, class II, DM beta)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 199 and 263 of HLA-DMB (Uniprot ID#P28068)

HLA-DRA (C-term) rabbit polyclonal antibody

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 149-177 amino acids from the C-terminal region of human HLA-DRA.

HLA-DRB5 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 43~70 amino acids from the Central region of human HLA class II DRB5 beta / HLA-DRB5