Autoimmunity

Jump to Filters
View as table Download
IL18 Rabbit Polyclonal Antibody
TA324190

USD 380.00

2 Weeks

Anti-IL18 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein
TA324190 is a possible alternative to TA324189.
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA336742

USD 550.00

2 Weeks

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]
IL6 Goat Polyclonal Antibody
PP1028P1

USD 345.00

2 Weeks

IL6 goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (> 98%), 20.9 kDa  E.coli derived recombinant Human IL-6
IL6 Goat Polyclonal Antibody
PP1028P2

USD 465.00

2 Weeks

IL6 goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (> 98%), 20.9 kDa  E.coli derived recombinant Human IL-6
IL18 Goat Polyclonal Antibody
TA305919

USD 520.00

2 Weeks

Goat Anti-IL18 Antibody

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1.
IL18 Rabbit Polyclonal Antibody
TA343041

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL18 antibody: synthetic peptide directed towards the C terminal of human IL18. Synthetic peptide located within the following region: IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA319141

USD 1,795.00

5 Days

Rabbit polyclonal IL-1 beta antibody

Applications WB
Reactivities Human, Primate, Dog
Conjugation Unconjugated
Immunogen This antibody was prepared by repeated immunizations with recombinant human IL-1β produced in E.coli. The MW of the recombinant 153 aa IL-1β was 17 kDa with the N-terminal amino acid at position alanine 117. This cleavage site is generated by the IL-1β converting enzyme (ICE, capase-1).