Autoimmunity

View as table Download

IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL1F9 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL1F9 mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal IL-36G Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-36G antibody was raised against a 13 amino acid peptide near the carboxy terminus of human IL-36G.

IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal antibody to IL1F9 (interleukin 1 family, member 9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 105 and 169 of IL1F9 (Uniprot ID#Q9NZH8)

IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-IL36G Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL36G Antibody is: synthetic peptide directed towards the middle region of Human IL36G. Synthetic peptide located within the following region: ITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLY