CSRP2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CSRP2 |
CSRP2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CSRP2 |
Goat Polyclonal Antibody against CRP2 / CSRP2
Applications | WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Horse) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ERLGIKPESVQP, from the internal region of the protein sequence according to NP_001312.1. |
Rabbit Polyclonal Anti-Csrp2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Csrp2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPW |
CSRP2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human CSRP2 (NP_001312.1). |
Modifications | Unmodified |