Anti-AGBL5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human ATP/GTP binding protein-like 5 |
Anti-AGBL5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human ATP/GTP binding protein-like 5 |
Rabbit polyclonal AGBL5 Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Bovine) |
Conjugation | Unconjugated |
Immunogen | This AGBL5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 99-127 amino acids from the N-terminal region of human AGBL5. |
Rabbit Polyclonal Anti-AGBL5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AGBL5 Antibody: synthetic peptide directed towards the C terminal of human AGBL5. Synthetic peptide located within the following region: RGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLSRARSFSTGTSAGG |
Rabbit Polyclonal Anti-AGBL5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AGBL5 Antibody: synthetic peptide directed towards the C terminal of human AGBL5. Synthetic peptide located within the following region: NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS |