Rabbit polyclonal TERF2IP Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This TERF2IP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 349-378 amino acids from the C-terminal region of human TERF2IP. |
Goat Anti-RAP1 / TERF2IP Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Cow, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GAQNVARRIEFRKK, from the C Terminus of the protein sequence according to NP_061848.2. |
Mouse Monoclonal TERF21P Antibody (78B356.1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TERF2IP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TERF2IP antibody: synthetic peptide directed towards the middle region of human TERF2IP. Synthetic peptide located within the following region: EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV |
Rabbit Polyclonal Anti-TERF2IP Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Terf2ip antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHK |
TERF2IP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human TERF2IP |
TERF2IP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TERF2IP |
Germany
Japan
United Kingdom
China
