Germany
Japan
United Kingdom
China
Heterochromatin Markers
View as table Download
USD 509.00
2 Weeks
Rabbit Polyclonal Anti-USP48 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-USP48 Antibody: synthetic peptide directed towards the C terminal of human USP48. Synthetic peptide located within the following region: PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS |
Rabbit Polyclonal Anti-USP48 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-USP48 Antibody: synthetic peptide directed towards the middle region of human USP48. Synthetic peptide located within the following region: ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYV |
USP48 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human USP48 |
Active filters
Families
- Transmembrane