Purified CD63 mouse monoclonal antibody, clone OTI5E5 (formerly 5E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Purified CD63 mouse monoclonal antibody, clone OTI5E5 (formerly 5E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD63 mouse monoclonal antibody, clone OTI5E5 (formerly 5E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Purified CD63 mouse monoclonal antibody, clone OTI5E5 (formerly 5E5), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Purified CD63 mouse monoclonal antibody, clone OTI5E5 (formerly 5E5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Purified CD63 mouse monoclonal antibody, clone OTI5E5 (formerly 5E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CD63 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Anti-CD63 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. |
CD63 mouse monoclonal antibody,clone 2G6, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) CD63 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD63 mouse monoclonal antibody,clone 2G6, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
CD82 mouse monoclonal antibody, clone C33, Aff - Purified
Applications | FC, FN, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD9 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 100-150 of Human CD9. |
CD63 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CD81 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Carrier-free (BSA/glycerol-free) CD63 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |