Goat Polyclonal Anti-EEA1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 1230 aa to the C-terminus of human EEA1 produced in E. coli. |
Goat Polyclonal Anti-EEA1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 1230 aa to the C-terminus of human EEA1 produced in E. coli. |
Goat Polyclonal Anti-EEA1 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 1,230 aa to the C-terminus of human EEA1 produced in E. coli. |
Rabbit Polyclonal anti-EEA1 antibody
Applications | IHC, IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the N terminal of human EEA1. Synthetic peptide located within the following region: LTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSAS |
Rabbit Polyclonal Anti-EEA1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EEA1 antibody: synthetic peptide directed towards the N terminal of human EEA1. Synthetic peptide located within the following region: ESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDD |