Germany
Japan
United Kingdom
China
Endosomal Marker Antibodies
View as table Download
EGFR mouse monoclonal antibody,clone UMAB95
| Applications | 10k-ChIP, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ERBB2 mouse monoclonal antibody, clone OTI4F10 (formerly 4F10)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
EGFR mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-CAV2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAV2 antibody: synthetic peptide directed towards the N terminal of human CAV2. Synthetic peptide located within the following region: LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSE |
USD 494.00
3 Weeks
Rabbit Polyclonal Caveolin-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caveolin-1 |
Active filters
Families
- Transmembrane
Pathways
- Focal adhesion
Citations
- Yes