Endosomal Marker Antibodies

View as table Download

EGFR mouse monoclonal antibody,clone UMAB95

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Goat Polyclonal Anti-Rab11 Antibody

Applications IHC, WB
Reactivities Canine, Human, Monkey, Rat, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab11a, Rab11b and Rab11c (Rab25) produced in E. coli.

EGFR mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-RAB11B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB11B antibody: synthetic peptide directed towards the C terminal of human RAB11B. Synthetic peptide located within the following region: IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV

purified EGFR biotinylated mouse monoclonal detection antibody, validated for Luminex assays

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600469, TA600472

Goat Polyclonal Antibody against RAB11A / YL8

Applications WB
Reactivities Mouse (Expected from sequence similarity: Human, Rat, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence TENKPKVQCCQNI, from the C Terminus of the protein sequence according to NP_004654.