Endosomal Marker Antibodies

View as table Download

Goat Polyclonal Anti-Rab11b Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Rat, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab11b produced in E. coli.

Rabbit Polyclonal Anti-RAB11B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB11B antibody: synthetic peptide directed towards the C terminal of human RAB11B. Synthetic peptide located within the following region: IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV