CAV1 mouse monoclonal antibody,clone OTI2C4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CAV1 mouse monoclonal antibody,clone OTI2C4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CAV1 mouse monoclonal antibody,clone OTI2C4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
CAV1 mouse monoclonal antibody,clone OTI2C4, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
CAV1 mouse monoclonal antibody,clone OTI2C4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CAV1 mouse monoclonal antibody,clone OTI2C4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against Caveolin 1 (7C8)
Applications | FC, ICC/IF, IHC, Immunoblotting, IP, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CAV1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CAV1 |
Rabbit Polyclonal Anti-CAV1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID |
Caveolin 1 (CAV1) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide from C-terminal domain of human caveolin-1 |