Germany
Japan
United Kingdom
China
Rabbit Polyclonal anti-CFTR Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CFTR |
TA890106 is the same product as TA374684.
Endosomal Marker Antibodies
View as table DownloadRabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Drosophila) |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ADRB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS |
Rabbit polyclonal CAV2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CAV2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 11-44 amino acids from the N-terminal region of human CAV2. |
Rabbit Polyclonal antibody to Caveolin 2 (caveolin 2)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Rat, Dog, Feline, Pig, Rabbit, Sheep, Bovine, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of Caveolin 2 |
Rabbit Polyclonal Anti-FUS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUS antibody: synthetic peptide directed towards the N terminal of human FUS. Synthetic peptide located within the following region: MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGY |
Rabbit polyclonal ERBB2 Antibody(N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | This ERBB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 21-52 amino acids from the N-terminal region of human ERBB2. |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Druggable Genome
Filter by
Target Symbol
Reactivities
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Focal adhesion (89)
- Adherens junction (74)
- Bladder cancer (74)
- Endometrial cancer (74)
- ErbB signaling pathway (74)
- Non-small cell lung cancer (74)
- Pancreatic cancer (74)
- Pathways in cancer (74)
- Prostate cancer (74)
- Calcium signaling pathway (73)
- MAPK signaling pathway (68)
- GnRH signaling pathway (57)
- Gap junction (56)
- Colorectal cancer (54)
- Dorso-ventral axis formation (54)
- Glioma (54)
- Melanoma (54)
- Regulation of actin cytoskeleton (54)
- Endocytosis (52)
- Cytokine-cytokine receptor interaction (46)
- Epithelial cell signaling in Helicobacter pylori infection (46)
- Type II diabetes mellitus (12)
- Alzheimer's disease (11)
- T cell receptor signaling pathway (11)
- Vascular smooth muscle contraction (11)
- Long-term depression (9)
- Long-term potentiation (9)
- Viral myocarditis (9)
- Acute myeloid leukemia (8)
- Axon guidance (8)
- B cell receptor signaling pathway (8)
- Chemokine signaling pathway (8)
- Chronic myeloid leukemia (8)
- Fc epsilon RI signaling pathway (8)
- Fc gamma R-mediated phagocytosis (8)
- Insulin signaling pathway (8)
- Melanogenesis (8)
- NOD-like receptor signaling pathway (8)
- Natural killer cell mediated cytotoxicity (8)
- Neurotrophin signaling pathway (8)
- Oocyte meiosis (8)
- Prion diseases (8)
- Progesterone-mediated oocyte maturation (8)
- Renal cell carcinoma (8)
- TGF-beta signaling pathway (8)
- Thyroid cancer (8)
- Toll-like receptor signaling pathway (8)
- VEGF signaling pathway (8)
- mTOR signaling pathway (8)
- Dilated cardiomyopathy (5)
- ABC transporters (4)
- Vibrio cholerae infection (4)
- Antigen processing and presentation (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Cardiac muscle contraction (3)
- Cell adhesion molecules (CAMs) (3)
- Hematopoietic cell lineage (3)
- Hypertrophic cardiomyopathy (HCM) (3)
- Lysosome (3)
- Primary immunodeficiency (3)
- Neuroactive ligand-receptor interaction (2)
- Taste transduction (1)