Endosomal Marker Antibodies

Jump to Filters
View as table Download
RAB11 FIP2 (RAB11FIP2) Rabbit Polyclonal Antibody
TA315185

USD 380.00

In Stock

Rabbit polyclonal anti-RAB11FIP2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAB11FIP2.
RAB11 FIP2 (RAB11FIP2) Rabbit Polyclonal Antibody
TA334557

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAB11FIP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB11FIP2 antibody: synthetic peptide directed towards the N terminal of human RAB11FIP2. Synthetic peptide located within the following region: LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF