Germany
Japan
United Kingdom
China
USD 380.00
4 Weeks
Cytoskeleton Marker Antibodies
View as table Download
USD 380.00
4 Weeks
USD 380.00
4 Weeks
Rabbit polyclonal Anti-Tppp Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tppp antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGYKHAGTYDQKVQ |
Rabbit polyclonal Anti-Tppp Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tppp antibody: synthetic peptide directed towards the C terminal of mouse 2900041A09RIK. Synthetic peptide located within the following region: KAVSSPTVSRLTDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGY |
USD 365.00
3 Weeks
TPPP/p25 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-219 of human TPPP/p25 (NP_008961.1). |
| Modifications | Unmodified |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- TPPP