Germany
Japan
United Kingdom
China
USD 509.00
2 Weeks
MASP2 mouse monoclonal antibody,clone OTI4D4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Cytoskeleton Marker Antibodies
View as table Download
MASP2 mouse monoclonal antibody,clone OTI4D4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
MASP2 mouse monoclonal antibody,clone OTI5C4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MASP2 mouse monoclonal antibody,clone OTI5C4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
MASP2 mouse monoclonal antibody,clone OTI7C4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MASP2 mouse monoclonal antibody,clone OTI7C4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
MASP2 mouse monoclonal antibody,clone OTI7D4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MASP2 mouse monoclonal antibody,clone OTI7D4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
MASP2 mouse monoclonal antibody,clone OTI2F10, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MASP2 mouse monoclonal antibody,clone OTI2F10, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MASP2 mouse monoclonal antibody,clone OTI2F10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-METAP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METAP2 antibody: synthetic peptide directed towards the N terminal of human METAP2. Synthetic peptide located within the following region: ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR |
Rabbit Polyclonal Anti-UCHL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the C terminal of human UCHL5. Synthetic peptide located within the following region: KRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK |
Rabbit Polyclonal Anti-UCHL5 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the middle region of human UCHL5. Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK |
Rabbit polyclonal MASP1 (heavy chain, Cleaved-Arg448) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MASP1. |
Active filters
Reactivities
- Human
Applications
- WB
Families
- Protease