Germany
Japan
United Kingdom
China
USD 447.00
In Stock
Cytoskeleton Marker Antibodies
View as table Download
USD 600.00
3 Days
USD 200.00
2 Days
MASP2 mouse monoclonal antibody,clone OTI2F10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MASP2 mouse monoclonal antibody,clone OTI4D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MASP2 mouse monoclonal antibody,clone OTI5C4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MASP2 mouse monoclonal antibody,clone OTI7C4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MASP2 mouse monoclonal antibody,clone OTI7D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI4D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI5C4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI7C4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI7D4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI2F10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MASP2 mouse monoclonal antibody,clone OTI2F10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-METAP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METAP2 antibody: synthetic peptide directed towards the N terminal of human METAP2. Synthetic peptide located within the following region: ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR |
Active filters
Reactivities
- Human
Applications
- WB
Conjugates
- Unconjugated
Families
- Protease