GAPDHS mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GAPDHS mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GAPDHS mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
5 Days
GAPDHS mouse monoclonal antibody,clone 1F6, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
GAPDHS mouse monoclonal antibody,clone 1F6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
mouse Anti-Glyceraldehyde 3-Phosphate Dehydrogenase Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GAPDHS mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GAPDHS rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GAPDHS |
Rabbit Polyclonal Anti-GAPDHS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GAPDHS |
Rabbit Polyclonal Anti-GAPDHS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GAPDHS antibody: synthetic peptide directed towards the N terminal of human GAPDHS. Synthetic peptide located within the following region: PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI |
GAPDHS Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 179-408 of human GAPDHS (NP_055179.1). |
Modifications | Unmodified |
GAPDHS mouse monoclonal antibody, clone Hs-8, Purified
Applications | FC, IF, WB |
Reactivities | Human, Porcine |
Conjugation | Unconjugated |