Cytoplasm Marker Antibodies

View as table Download

GAPDHS mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GAPDHS mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

mouse Anti-Glyceraldehyde 3-Phosphate Dehydrogenase Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GAPDHS mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-GAPDHS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GAPDHS

Rabbit Polyclonal Anti-GAPDHS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAPDHS antibody: synthetic peptide directed towards the N terminal of human GAPDHS. Synthetic peptide located within the following region: PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI