Rabbit polyclonal TUBA1/3/4 (Ab-272) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TUBA1/3/4 around the phosphorylation site of tyrosine 272 (A-T-YP-A-P). |
Rabbit Polyclonal Tubulin alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Tubulin alpha |
Rabbit Polyclonal Tubulin beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Tubulin beta |
TUBB4Q (TUBB7P) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 63-93 amino acids from the N-terminal region of human TUBB4Q |
TUBB6 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 146-174 amino acids from the Central region of human TUBB6 |
Rabbit polyclonal alpha-Tubulin antibody
| Applications | WB |
| Reactivities | Human, Mouse, Bovine, Rat, Chicken |
| Conjugation | Unconjugated |
| Immunogen | Anti-Tubulin Loading Control Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 427-441 of Human alpha Tubulin. |
Rabbit Polyclonal Alpha-tubulin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal Tubulin antibody was raised against a 16 amino acid peptide near the amino terminus of human Tubulin. |
Rabbit Polyclonal Anti-TUBA3D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TUBA3D antibody is: synthetic peptide directed towards the C-terminal region of Human TUBA3D. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSVEAEAEEGE |
Rabbit Polyclonal Anti-TUBA3C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR |
Rabbit Polyclonal Anti-Tubb2a Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Tubb2a antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tubb2a. Synthetic peptide located within the following region: RKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEE |
Rabbit Polyclonal Anti-TUBA4A Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH |
Rabbit Polyclonal Anti-Tubulin alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tubulin alpha Antibody: A synthesized peptide derived from human Tubulin alpha |
Rabbit anti Tubulin beta Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to aa 416-430 of human tubulin beta. This sequence is identical among human, rat, mouse, bovine, guinea pig, chicken, gerbil, frog, yeast, fungi, sea urchin, Myxamoeba and plasmodium. |
Rabbit anti Tubulin alpha Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to aa 426-450 of human tubulin. This sequence is identical among human, rat, mouse, bovine, guinea pig, gerbil, frog and chicken. |
Rabbit Polyclonal Anti-Alpha-tubulin Antibody (biotin)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Rabbit, Chicken, Zebrafish |
| Conjugation | Biotin |
| Immunogen | Biotin-Alpha-tubulin antibody was raised against an 18 amino acid peptide near the carboxy terminus of human alpha-tubulin |
Germany
Japan
United Kingdom
China