Cytoplasm Marker Antibodies

View as table Download

Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437.

Rabbit Polyclonal Anti-TUBA4A Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE

1 star1 star1 star1 star1 star Reviews (1)

Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)

Applications IF, IHC, WB
Reactivities Human, Drosophila, Rat, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A

Rabbit Polyclonal antibody to beta Tubulin (tubulin, beta)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 238 and 429 of beta Tubulin

Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Chimpanzee, Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 227 and 440 of alpha Tubulin 1A (Uniprot ID#Q71U36)

Anti-TUBB3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 57-294 amino acids of Human Tubulin beta-3 chain

Rabbit Polyclonal antibody to alpha Tubulin (tubulin, alpha 1b)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Pig, Chimpanzee, Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 118 and 365 of alpha Tubulin (Uniprot ID#P68363)

Rabbit polyclonal Tubulin a antibody

Applications IF, IHC, WB
Reactivities Mouse, Rat, Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Tubulin α.

Rabbit Polyclonal Anti-alpha-Tubulin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen alpha-Tubulin antibody was raised against an 18 amino acid peptide near the carboxy terminus of human alpha-Tubulin

Rabbit polyclonal TUBB2B Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig, Monkey, Xenopus)
Conjugation Unconjugated
Immunogen This TUBB2B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-39 amino acids from the N-terminal region of human TUBB2B.

Rabbit polyclonal anti-Tubulin beta (TUBB3) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Tubulin β.

Anti-TUBA4A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 127-447 amino acids of Human Tubulin alpha-4A chain

Rabbit Polyclonal Anti-TUBB2A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the middle region of human TUBB2A. Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC

Rabbit anti Tubulin beta Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to aa 416-430 of human tubulin beta. This sequence is identical among human, rat, mouse, bovine, guinea pig, chicken, gerbil, frog, yeast, fungi, sea urchin, Myxamoeba and plasmodium.